General Information

  • ID:  hor003115
  • Uniprot ID:  Q9GQV7
  • Protein name:  Decapeptide 1
  • Gene name:  HP-I
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Expressed in the brain, terminal ganglion, and midgut of adults: numerous neurosecretory cells and midgut endocrine cells. Expression is dynamic depending on reproductive cycle.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0032539 negative regulation of host-seeking behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QRPPSLKTRF
  • Length:  10(23-32)
  • Propeptide:  MWKFASIVVLVVCLAWAVYCEDQRPPSLKTRFGRSADEPESDNYVSNDIMEKRSAQRPPSLKTRFGRSEGAEVMEKRSAQRPPSLKTRFGRSVANPESDGYMRKRSAESEPFVTRIRHGRANKKRAAN
  • Signal peptide:  MWKFASIVVLVVCLAWAVYCED
  • Modification:  T1 Pyrrolidone carboxylic acid;T4 Hydroxyproline;T10 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Has a role in inhibiting host-seeking behavior during a reproductive cycle
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A8MRM1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-A8MRM1-F1.pdbhor003115_AF2.pdbhor003115_ESM.pdb

Physical Information

Mass: 139014 Formula: C55H92N18O14
Absent amino acids: ACDEGHIMNVWY Common amino acids: PR
pI: 12.52 Basic residues: 3
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -145 Boman Index: -3900
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 39
Instability Index: 5829 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  Isolation and primary structure of neuropeptides from the mosquito, Aedes aegypti, immunoreactive to FMRFamide antiserum.